PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN43704.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YA
Protein Properties Length: 330aa    MW: 36385 Da    PI: 9.2289
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN43704.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA94.11.7e-29161216258
   CBFB_NFYA   2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  p YVNaKQy++I++RRq+Rak+  e+k+ +k rkpy+heSRh hA rRpRg+gGrF
  KHN43704.1 161 GPTYVNAKQYHGIIRRRQSRAKAVLENKM-IKRRKPYMHESRHLHATRRPRGCGGRF 216
                 699**************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005214.0E-33158219IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.83159219IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.1E-25162216IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-21162184IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006161.2E-21193216IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAMQTVYLKE HEGLVHSSVG QLSSVTSAPW WSALGSQPVY GEYCGQMKSF SLEISNYVDQ  60
FGAGKQAARG VEQLLDKGHT TQFTIFPDDC KMSGDAQNPQ ATLSLQSSLA EPHNRFEIGV  120
NQPMICAKYP YMDQFYGLFS AYGPQISGRI MLPINLTSDE GPTYVNAKQY HGIIRRRQSR  180
AKAVLENKMI KRRKPYMHES RHLHATRRPR GCGGRFLNTK SSTDGNGKNE SEVIKTSGRQ  240
FQSSASQSSE VLQSEVGMLN SSKQTNRSSP NISGSEVTSM YSREGFDGFS VNPLGSSVHS  300
LADMMGSEHG IIMPTKWVAA VPGNCYNLKI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-16160220262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174193RRRQSRAKAVLENKMIKRRK
2174194RRRQSRAKAVLENKMIKRRKP
3175194RRQSRAKAVLENKMIKRRKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014623884.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
RefseqXP_014623885.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like isoform X2
TrEMBLA0A0B2SHG70.0A0A0B2SHG7_GLYSO; Nuclear transcription factor Y subunit A-10
STRINGGLYMA02G35190.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37943464
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.21e-58nuclear factor Y, subunit A10
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]